- GABPA Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84941
- Rabbit
- E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A, RCH04A07
- 0.1 ml
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: YDGDMICKVQ GKRFVYKFVC DLKTLIGYSA AELNRLVTEC EQKKLAKMQL HGIAQPVTAV ALATASLQTE KDN
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- GABPA
- PBS (pH 7.2) and 40% Glycerol
- Human
- GA binding protein transcription factor subunit alpha
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
YDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Specifications/Features
Available conjugates: Unconjugated